PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g030120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 610aa    MW: 69559.6 Da    PI: 6.2511
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g030120.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3501.44.5e-153514281353
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       +el++rmw+d+m+lkrlke++k+    ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+
  Sopen06g030120.1  51 DELERRMWRDKMKLKRLKEMSKS----KEG-VDPAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRE 138
                       79*******************98....677.8999********************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWk+kv+fdrngpaai+kyqa+++i++ +++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww++lgl
  Sopen06g030120.1 139 WWKDKVRFDRNGPAAIAKYQADHAIPGMNEGSNP-VGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGQEDWWPQLGL 230
                       ********************************87.99******************************************************** PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXXXXXXXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkqspkvtl 276
                        kdqg  pykkphdlkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l++++qee+++++++++  ++ s+   s ++ l
  Sopen06g030120.1 231 HKDQGSLPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIISQEEALARELYPDrcPPlSSAGVSGNFML 323
                       *****************************************************************************8633566779****** PP

                       XXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XX CS
              EIN3 277 sceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgset 339
                       ++++++dveg +++   +v+++k ++                              ++++  krk +  e++ ++++++ +tc+  q++++e 
  Sopen06g030120.1 324 NDSSEYDVEGAQDEPNFDVHEQKPNHlnllnicaerfketmplqqqshpnkdelitNLDFSLKRK-QANEPTVMMDQKI-YTCEFLQCPHNEL 414
                       *********777777799999999999*****************************99******9.7888899988876.************* PP

                       XXXXXXXXXXXXXX CS
              EIN3 340 elifadknsisqne 353
                       +++f+d++s+++++
  Sopen06g030120.1 415 RHGFQDRSSRDNHQ 428
                       ************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.0E-12851298No hitNo description
Gene3DG3DSA:1.10.3180.103.6E-74172308IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.62E-60177301IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MMMFEEMGFC GDLDFFPAPL KEVEVSAPQS QTEPDSVVDD DYSDEEEIEV DELERRMWRD  60
KMKLKRLKEM SKSKEGVDPA KQRQSQEQAR RKKMSRAQDG ILKYMLKMME VCKAQGFVYG  120
IIPEKGKPVS GASDNLREWW KDKVRFDRNG PAAIAKYQAD HAIPGMNEGS NPVGPTPHTL  180
QELQDTTLGS LLSALMQHCD PPQRRFPLEK GVPPPWWPTG QEDWWPQLGL HKDQGSLPYK  240
KPHDLKKAWK VGVLTAVIKH MFPDIAKIRK LVRQSKCLQD KMTAKESATW LAIISQEEAL  300
ARELYPDRCP PLSSAGVSGN FMLNDSSEYD VEGAQDEPNF DVHEQKPNHL NLLNICAERF  360
KETMPLQQQS HPNKDELITN LDFSLKRKQA NEPTVMMDQK IYTCEFLQCP HNELRHGFQD  420
RSSRDNHQFA CLYRSSSRFG VSNFQINEVK PVVFPQQYVQ PKSSALPVNQ GPPSFDLSGI  480
GVPEDGQRMI NELMSIYDSD VQGSKRQNRG NIALTKEQPH QQPRVHQDNY LLSQGIMDGN  540
IFKNTNISTT QSMLPQVDPF DQSKAFNAGS NDNFHFMFGS PFNIQSTNYN GNLPSIGYDT  600
TPKQDAPIWY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-851763072133Protein ETHYLENE INSENSITIVE 3
4zds_B7e-851763072133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079067.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_015079066.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLQ94FV40.0Q94FV4_SOLLC; EIL1
STRINGSolyc06g073720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein